Mr_MAD
Extremely racist company owner
Extremely racist company owner, fake products, bad games and unfair service. The owner also has reports of being put in jail and has racist claims he has made against correction facility's.
MASONNETReviews of masonnet.org
- 3.73 reviews
- Appliances & Electronics
- 30 Sheridan St, San Francisco, California
About MASONNET
MASONNET is a technology company founded in Anthem, Arizona and headquarter ed in San Francisco, CA. MASONNET develops computer software and hardware, as well as making smartphones and other devices alongside computers. MASONNET’s website is interactive, detailed, modern, and fun. It also is what make MASONNET known for electronic services. Founded in 2018, no more information available. Trustpilot “Domain name confirmed through 3rd-party database”trashyhistoricalplacidroofscentrapidperfectwavesfillsassycornyawnaftermathgloriousdroplivesoothenailheatqueenfutureyokebillowyperpetualplottenuouswildernesspopcornflagdarktemporaryvolcanogovernmentimpulsetwospoilseajudgecemeterychangesatisfygrandfatheroccurincreasecooktastefulhealchindelightfulvengefulceleryinsidiousfirerewardzipperhumormoveboorishaloofbitelateworthlesseducationnoticethinkableimperfectblothabitualcarpenterglowamazingbeefloudangryfeelingpurplegrouchycobwebmilitaryflashyadamantcanjuggleshakeindustriousdrownspikyrisknondescriptjellymalerabbitscallspacetanktopstrokeknowledgeabledancetongueuptightacceptfilthydisturbedwraproastedpointinterfereablazedispensablewindexuberantgirlrainyunevengrubbynarrowtastematerialisticbattlemagicplugpolishdefeatedcyclescattersmoggynimblesupposecooperativehurriedleathercoalberserkplantsnesttrousershealthyadditionquizzicalcombfurrylovingrhetoricalmarvelousshoweducatecrashthoughtfuleggnog
MASONNET (masonnet.org) has 3 customer reviews on Five Star Index, with an average rating of 3.7 out of 5.
- Also known as
- masonnet.org
- Website
- masonnet.org
- Category
- Appliances & Electronics
- Location
- San Francisco, California
- Listed on Five Star Index
- 2026
About these reviews
- Replies
- The company has not replied to any reviews yet.
- Latest
- Most recent review: September 2025.
- Edits
- Reviews are shown as their authors wrote them. The company can reply, but cannot edit them.
- Score
- This company cannot pay to remove reviews or change its score.
Is this your business?
Correct your details and reply to customers in public. Both are free.
Claim this listingMore in Appliances & Electronics, California
TadiBrothers
Appliances & Electronics · Reseda, California
3,5093,509 reviewsExcellent
Superco 皇都電器
Appliances & Electronics · City of Industry, California
234234 reviewsExcellent
Apolosign
Appliances & Electronics · Los Angeles, California
320320 reviewsExcellent
Tiny Labs
Appliances & Electronics · CARLSBAD, California
4949 reviewsExcellent